PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016651150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Dof
Protein Properties Length: 332aa    MW: 35233.3 Da    PI: 7.358
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016651150.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-383593361
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    ++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+r+ k+s
  XP_016651150.1 35 QQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRQTKSS 93
                    7899***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.9E-333692IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-273690IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1343892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MQDIHSVGGA RFFAGSGGGG GGGDRRLRPH HHLNQQALKC PRCDSLNTKF CYYNNYNLSQ  60
PRHFCKSCRR YWTKGGVLRN VPVGGGCRQT KSSKPQISSN SSPSSSPPPS PPQPNSATDQ  120
HKASSHSSSE SSSLTNTTTA AAAAATATEA VSAPSSTGSA SNLLRNIHRQ ESKFFGSQSG  180
GFEPGAAAAL LEQSTEMNGM FSEIGSFTSL ITSSNDLPFG FGNIGGTDAS VSPFRVNQQA  240
QGHHQNQWGQ QNQSEELKMQ ELSGGLMDQT GQVDLSVFHG RSNGGGGGVF GSLDWQAGSG  300
DQGLFDLPNT VDQAYWSQSQ WTDQDHPTLY LP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572544e-58DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209350.10.0hypothetical protein PRUPE_ppa008568mg
TrEMBLM5WA030.0M5WA03_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03520.16e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-51OBF binding protein 4